Journal: Journal of Anatomy

Article Title: Scar-free cutaneous wound healing in the leopard gecko, Eublepharis macularius

doi: 10.1111/joa.12368

Figure Lengend Snippet: Summary table of the optimised immunohistochemistry and immunofluorescence protocols for proteins of interest

Article Snippet: Slides were then coverslipped using Cytoseal (TM) (Fischer Scientific). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Antigen Type Retrieval Block Primary Secondary HRP DAB WE6 IHC 12 min citrate buffer 3% NGS 1.5 h RT Mouse anti-WE6 1 : 5 (Developmental Studies Hybridoma Bank WE6-s) Biotinylated goat anti-mouse 1 : 200 (Vector Laboratories BA-9200) 1 : 200 40 s PCNA IHC None 3% NGS 1 h RT Rabbit anti-PCNA 1 : 500 (Santa Cruz Biotechnology, Inc. sc-7907) Biotinylated goat anti-rabbit 1 : 200 (Jackson ImmunoResearch Laboratories, 111-066-003) 1 : 200 25 s VEGF IHC 12 min citrate buffer 3% NGS 1 h RT Rabbit anti-VEGF 1 : 100 (Santa Cruz Biotechnology, Inc. sc-152) Biotinylated goat anti-rabbit 1 : 500 (Jackson ImmunoResearch Laboratories, 111-066-003) 1 : 200 25 s TSP-1 IHC 12 min citrate buffer 3% NGS 1 h RT Mouse anti-Thrombospondin 1 1 : 50 (Santa Cruz Biotechnology, sc-59887) Biotinylated goat anti-mouse 1 : 500 (Vector Laboratories BA-9200) 1 : 200 40 s vWF IF None 3% NGS 1 h RT Rabbit anti-vonWillebrand Factor 1 : 500 (Dako Canada, A0082) Cy3 goat anti-rabbit 1 : 400 (Jackson ImmunoResearch Laboratories, 111-165-144) α-SMA IF None 3% NGS 1 h RT Mouse anti-α-Actin 1 : 400 (Santa Cruz Biotechnology, sc-32251) Goat anti-mouse AlexaFluor-488 1 : 400 (Life Technologies, A-11001) Open in a separate window Summary table of the optimised immunohistochemistry and immunofluorescence protocols for proteins of interest Immunofluorescence To visualise blood vessels, double-labelled immunofluorescence, for both vonWillebrand factor (vWF; expressed by endothelial cells) and α-smooth muscle actin (α-SMA; expressed by perivascular cells), was performed.

Techniques: Immunohistochemistry, Immunofluorescence, Blocking Assay, Plasmid Preparation, Immunohistochemistry-IF

Journal: European Spine Journal

Article Title: Penetration of linezolid into rabbit intervertebral discs and surrounding tissues

doi: 10.1007/s00586-010-1548-x

Figure Lengend Snippet: Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with linezolid

Article Snippet: Iliopsoas muscle extract obtained from rabbits injected with vancomycin, meanwhile, had no inhibition zone diameter (Table ). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Strain Zone diameter (mm) Tissue specimens LZD (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 20 μg/ml 10 μg/ml ATCC 33591 Median 13.2 13.8 9.4 ND ND 13.4 9.6 Range 12.2–14.4 12.0–15.8 8.4–10.0 ND ND 12.0–14.0 8.4–10.0 Clinically isolated Median 14.4 13.8 7.9 ND ND 13.4 9.3 Range 13.3–14.5 13.2–15.1 7.2–8.6 ND ND 13.2–13.8 9–9.7 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with linezolid table ft1 table-wrap mode="anchored" t5 Table 2 caption a7 Strain Zone diameter (mm) Tissue specimens VCM (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 120 μg/ml 30 μg/ml ATCC 33591 Median 11.2 11.1 ND ND ND 12.2 10.5 Range 10.7–11.7 11–11.3 ND ND ND 11.8–12.6 10.3–10.8 Clinically isolated Median 12 11.4 ND ND ND 10.9 8.6 Range 11.7–12.3 11.0–12.0 ND ND ND 10.4–11.4 7.2–9.0 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with vancomycin

Techniques: Inhibition, Injection, Clinical Proteomics, Control, Isolation

Journal: European Spine Journal

Article Title: Penetration of linezolid into rabbit intervertebral discs and surrounding tissues

doi: 10.1007/s00586-010-1548-x

Figure Lengend Snippet: Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with vancomycin

Article Snippet: Iliopsoas muscle extract obtained from rabbits injected with vancomycin, meanwhile, had no inhibition zone diameter (Table ). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Strain Zone diameter (mm) Tissue specimens LZD (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 20 μg/ml 10 μg/ml ATCC 33591 Median 13.2 13.8 9.4 ND ND 13.4 9.6 Range 12.2–14.4 12.0–15.8 8.4–10.0 ND ND 12.0–14.0 8.4–10.0 Clinically isolated Median 14.4 13.8 7.9 ND ND 13.4 9.3 Range 13.3–14.5 13.2–15.1 7.2–8.6 ND ND 13.2–13.8 9–9.7 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with linezolid table ft1 table-wrap mode="anchored" t5 Table 2 caption a7 Strain Zone diameter (mm) Tissue specimens VCM (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 120 μg/ml 30 μg/ml ATCC 33591 Median 11.2 11.1 ND ND ND 12.2 10.5 Range 10.7–11.7 11–11.3 ND ND ND 11.8–12.6 10.3–10.8 Clinically isolated Median 12 11.4 ND ND ND 10.9 8.6 Range 11.7–12.3 11.0–12.0 ND ND ND 10.4–11.4 7.2–9.0 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with vancomycin

Techniques: Inhibition, Injection, Clinical Proteomics, Control, Isolation

Journal: European Spine Journal

Article Title: Penetration of linezolid into rabbit intervertebral discs and surrounding tissues

doi: 10.1007/s00586-010-1548-x

Figure Lengend Snippet: Penetration efficacy into (a) annulus fibrosus, (b) nucleus pulposus, (c) bone marrow, (d) iliopsoas muscle, and (e) vertebral bone at 0.33 h after linezolid or vancomycin injection. Penetration efficiency was defined as tissue concentration/plasma concentration ×100 (%). *P < 0.05

Article Snippet: Iliopsoas muscle extract obtained from rabbits injected with vancomycin, meanwhile, had no inhibition zone diameter (Table ). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Strain Zone diameter (mm) Tissue specimens LZD (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 20 μg/ml 10 μg/ml ATCC 33591 Median 13.2 13.8 9.4 ND ND 13.4 9.6 Range 12.2–14.4 12.0–15.8 8.4–10.0 ND ND 12.0–14.0 8.4–10.0 Clinically isolated Median 14.4 13.8 7.9 ND ND 13.4 9.3 Range 13.3–14.5 13.2–15.1 7.2–8.6 ND ND 13.2–13.8 9–9.7 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with linezolid table ft1 table-wrap mode="anchored" t5 Table 2 caption a7 Strain Zone diameter (mm) Tissue specimens VCM (control) Plasma Bone marrow Iliopsoas muscle Vertebral bone Nucleus pulposus 120 μg/ml 30 μg/ml ATCC 33591 Median 11.2 11.1 ND ND ND 12.2 10.5 Range 10.7–11.7 11–11.3 ND ND ND 11.8–12.6 10.3–10.8 Clinically isolated Median 12 11.4 ND ND ND 10.9 8.6 Range 11.7–12.3 11.0–12.0 ND ND ND 10.4–11.4 7.2–9.0 Open in a separate window ND not detected Zone diameter of bacterial growth inhibition obtained with samples from rabbits injected with vancomycin

Techniques: Injection, Concentration Assay, Clinical Proteomics

Journal: International Wound Journal

Article Title: Fat grafting and platelet‐rich plasma for the treatment of diabetic foot ulcers: A feasibility‐randomised controlled trial

doi: 10.1111/iwj.13433

Figure Lengend Snippet: Distribution of offloading

Article Snippet: The offloading regimen chosen for each participant is summarised in Table . table ft1 table-wrap mode="anchored" t5 TABLE 3 caption a7 Total Control Fat grafting Fat grafting + platelet rich plasma Age (years), mean (range) 57.6 (35‐78) 55.2 (41‐69) 60.2 (45‐78) 57.5 (35‐71) Sex (M:F) 15:3 4:2 6:0 5:1 Body mass index (kg/m 2 ), mean (range) 29.3 (20.1‐42.9) 30.7 (24‐42.9) 26.9 (20.1‐30.3) 28.9 (24‐34.3) Insulin 11 3 5 3 Oral hypogylcaemics 14 6 5 3 HbA1C (mmol/mol), mean (range) 60 (31.1‐88) 53.9 (31.1‐74) 68.6 (55.2‐88) 57.6 (35.5‐82.5) Smoking Never 4 2 2 0 Ex‐smoker 11 2 4 5 Current 3 2 0 1 Peripheral vascular disease 6 2 2 2 Previous vascular intervention 5 1 2 2 Previous amputation 11 1 4 2 Charcot foot deformity 3 2 1 0 Previous long term antibiotic therapy 18 6 6 6 Size of ulcer Volume (mm 3 ) Mean (SD) 1489 (2655) 3105 (4123) 816 (1115) 546 (986) Median (range) 2300 (73‐11 120) 1996 (172‐11 120) 389 (111‐3000) 156 (73‐2556) Area (mm 2 ) Mean (SD) 360 (400) 640 (590) 310 (130) 130 (140) Median (range) 290 (25‐1750) 500 (120‐1750) 340 (110‐490) 65 (25‐340) Duration of ulcer (weeks) 47 (8‐132) 49 (20‐132) 41 (18‐88) 54 (8‐104) Wound location Plantar 10 3 3 4 Toe 3 2 1 0 Heel 4 0 2 2 Dorsum 1 1 0 0 Open in a separate window A summary of participant demographics table ft1 table-wrap mode="anchored" t5 TABLE 4 caption a7 Offloading regimen Control Fat Fat/platelet rich plasma Darco + Peggassist 1 2 2 Aircast boot 3 0 1 Removable cast 2 1 0 Own shoe 0 1 1 Total contact casting (TCC) 0 1 1 Backslab 0 0 1 Surgical shoe 0 1 0 Open in a separate window Distribution of offloading 3.2.

Techniques: Control, Clinical Proteomics

Journal: Ontario Health Technology Assessment Series

Article Title: Cell-Free Circulating Tumour DNA Blood Testing to Detect EGFR T790M Mutation in People With Advanced Non–Small Cell Lung Cancer: A Health Technology Assessment

doi:

Figure Lengend Snippet: EGFR Mutation Kits Approved by Health Canada

Article Snippet: Two kits are approved by Health Canada and are used to detect the EGFR mutation in blood samples ( ). table ft1 table-wrap mode="anchored" t5 Table 1: caption a7 Description Characteristic Therascreen EGFR Plasma RGQ PCR Kit Cobas EGFR Mutation Test Version 2 Manufacturer Qiagen Roche Licence number 97247 98447 Type Test kit Test kit Device class 3 3 First issue date 2016-07-08 2017-01-24 Detection method Analogue Semi-quantitative Detects 21 mutations Analogue Semi-quantitative Detects 42 mutations Open in a separate window Abbreviations: EGFR , epidermal growth factor resistance; PCR, polymerase chain reaction; RGQ, rotor-gene Q. EGFR Mutation Kits Approved by Health Canada Ontario and Canadian Context In Ontario, liquid biopsy is being used to detect the presence of the EGFR T790M resistance mutation in patients with NSCLC who are no longer responding (i.e., their cancer has progressed) to first- (gefitinib and erlotinib) or second-generation (afatinib) EGFR -TKI therapy.

Techniques: Mutagenesis, Clinical Proteomics

Journal: Ontario Health Technology Assessment Series

Article Title: Cell-Free Circulating Tumour DNA Blood Testing to Detect EGFR T790M Mutation in People With Advanced Non–Small Cell Lung Cancer: A Health Technology Assessment

doi:

Figure Lengend Snippet: EGFR T790M Testing Costs

Article Snippet: Two kits are approved by Health Canada and are used to detect the EGFR mutation in blood samples ( ). table ft1 table-wrap mode="anchored" t5 Table 1: caption a7 Description Characteristic Therascreen EGFR Plasma RGQ PCR Kit Cobas EGFR Mutation Test Version 2 Manufacturer Qiagen Roche Licence number 97247 98447 Type Test kit Test kit Device class 3 3 First issue date 2016-07-08 2017-01-24 Detection method Analogue Semi-quantitative Detects 21 mutations Analogue Semi-quantitative Detects 42 mutations Open in a separate window Abbreviations: EGFR , epidermal growth factor resistance; PCR, polymerase chain reaction; RGQ, rotor-gene Q. EGFR Mutation Kits Approved by Health Canada Ontario and Canadian Context In Ontario, liquid biopsy is being used to detect the presence of the EGFR T790M resistance mutation in patients with NSCLC who are no longer responding (i.e., their cancer has progressed) to first- (gefitinib and erlotinib) or second-generation (afatinib) EGFR -TKI therapy.

Techniques: Ubiquitin Proteomics, DNA Extraction, Sequencing, Mutagenesis, Digital PCR, Reverse Transcription Polymerase Chain Reaction, Next-Generation Sequencing

Journal: Acta Crystallographica. Section F, Structural Biology Communications

Article Title: Neutron crystallographic study of heterotrimeric glutamine amidotransferase CAB

doi: 10.1107/S2053230X19000220

Figure Lengend Snippet: Macromolecule-production information (Nakamura et al. , 2006 ▸ , 2010 ▸ )

Article Snippet: Macromolecule-production information is given in Table 1 . table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Source organism S. aureus Mu50 Cloning site NcoI/XhoI Expression vector pET-28b(+) vector (Novagen) Expression host E. coli B834 strain Complete amino-acid sequence of the construct produced GatA MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL GatB MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHHH GatC MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA Open in a separate window caption a8 Macromolecule-production information (Nakamura et al. , 2006 , 2010 ) 2.2.

Techniques: Clone Assay, Expressing, Plasmid Preparation, Sequencing, Construct, Produced

Journal: Blood Transfusion

Article Title: Principles of treatment and update of recommendations for the management of haemophilia and congenital bleeding disorders in Italy

doi: 10.2450/2014.0223-14

Figure Lengend Snippet: Plasma-derived and recombinant factor IX foncentrates available in Italy.

Article Snippet: Plasma-derived and recombinant factor VIII concentrates available in Italy. table ft1 table-wrap mode="anchored" t5 Table II caption a7 Plasma-derived FIX concentrates Brand (Company) Fractionation Viral inactivation Specific activity (IU/mg of total proteins) Comments AIMAFIX (Kedrion) Ion exchange chromatography, heparin affinity chromatography, filtration Solvent/detergent (TNBP/Tween 80) + dry heat 100 °C, 30 min 100 Antithrombin + Heparin + Albumin − 200 IU in 5 mL solvent.

Techniques: Clinical Proteomics, Recombinant, Fractionation, Activity Assay, Ion Exchange Chromatography, Affinity Chromatography, Filtration, Solvent, Chromatography, Pore Size, Hydrophobic Interaction Chromatography

Journal: Methods in enzymology

Article Title: Chemoenzymatic Synthesis and Applications of Prokaryote-Specific UDP-Sugars

doi: 10.1016/bs.mie.2017.06.003

Figure Lengend Snippet: Plasmids used in this manuscript.

Article Snippet: Transform plasmid into freshly-competent BL21 (DE3) RIL cells, growing transformants on LB-agar selection media containing corresponding vector selection antibiotic (see ) and 30 μg/mL CAM. table ft1 table-wrap mode="anchored" t5 Table 1. caption a7 Construct Vector Resistance Reference Addgene ID GST-PglFΔ1–130 ( Cj ) pGEX4T-2 Carb, 50 μg/mL Olivier et al., 2006 89708 His 8 -TEV-PglC ( Ng ) modified pET30b(+) Kan, 30 μμg/mL Hartley et al., 2011 89709 T7-PglD-His 6 ( Cj ) pET24a(+) Kan, 30 μg/mL Morrison et al., 2010 89710 PseB-His 6 ( Cj ) pET-24a(+) Kan, 30 μg/mL this report 89723 His 8 -TEV-PseC ( Cj ) modified pET30b(+) Kan, 30 μg/mL Hartley et al., 2011 89724 His 8 -TEV-PseH ( Cj ) modified pET30b(+) Kan, 30 μg/mL Hartley et al., 2011 89725 T7-WbpB-His 6 ( Pa ) pET-24a(+) Kan, 30 μg/mL Larkin et al., 2009 89711 T7-WbpE-His 6 ( Pa ) pET-24a(+) Kan, 30 μg/mL Larkin et al., 2009 89712 T7-WbpD-His 6 ( Pa ) pET-24a(+) Kan, 30 μg/mL Larkin et al., 2009 89713 T7-AglK-His 6 ( Mv ) pET-24a(+) Kan, 30 μg/mL Larkin et al., 2013 89714 T7-AglC-His 6 ( Mv ) pET-24a(+) Kan, 30 μg/mL Larkin et al., 2013 89726 Open in a separate window Plasmids used in this manuscript.

Techniques: Plasmid Preparation, Modification